{"product_id":"proteintech-22149-1-ap","title":"Proteintech, 22149-1-AP, GPR34 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPR34 (22149-1-AP) by Proteintech is a Polyclonal antibody targeting GPR34 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n22149-1-AP targets GPR34 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue, mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nG protein-coupled receptor 34 (GPR34) is a 7-transmembrane orphan receptor, belonging to the GPCR family, which affects multiple biological and physiological functions, such as cell proliferation and motility, immune infiltration, gene transcription.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17742 Product name: Recombinant human GPR34 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 267-381 aa of BC020678 Sequence: NSFIVLIIFTICFVPYHAFRFIYISSQLNVSSCYWKEIVHKTNEIMLVLSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEPSRSESTSEFKPGYSLHDTSVAVKIQSSSKST Predict reactive species\nFull Name: G protein-coupled receptor 34\nCalculated Molecular Weight: 381 aa, 44 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC020678\nGene Symbol: GPR34\nGene ID (NCBI): 2857\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UPC5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887657504937,"sku":"22149-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22149-1-ap","provider":"Iright","version":"1.0","type":"link"}