{"product_id":"proteintech-22161-1-ap","title":"Proteintech, 22161-1-AP, ZNF154 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZNF154 (22161-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF154 in WB, ELISA applications with reactivity to human, monkey samples\n22161-1-AP targets ZNF154 in WB, ELISA applications and shows reactivity with human, monkey samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COS-7 cells,  A549 cells,  HEK-293 cells,  MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSites that display recurrent, aberrant DNA methylation in cancer represent potential biomarkers for screening and diagnostics. Previously, The hypermethylation at the ZNF154 CpG island in 15 solid epithelial tumor types from 13 different organs. The magnitude and reproducibility of the ZNF154 hypermethylation signal across five solid tumor types reinforces the potential of this site as a biomarker for circulating tumor DNA (ctDNA)(PMID: 26857064 ). The calculated molecular weight of ZNF154 is 50 kDa, but the modified ZNF154 protein is about 55-60 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17812 Product name: Recombinant human ZNF154 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-165 aa of BC152404 Sequence: AVHFSWEEWGLLDEAQRCLYRDVMLENLALLTSLDVHRQKQHLGEKHFRSNVGRALFVKTCTFHVSGEPSTCREVGKDFLAKLGFLHQQAAHTGEQSNSKSDGGAISHRGKTHYNCGEHTKAFSGKHTLVQQQRTLTTERCYICSE Predict reactive species\nFull Name: zinc finger protein 154\nCalculated Molecular Weight: 437 aa, 50 kDa\nObserved Molecular Weight: 55-60 kDa\nGenBank Accession Number: BC152404\nGene Symbol: ZNF154\nGene ID (NCBI): 7710\nRRID: AB_2879012\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13106\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887938359465,"sku":"22161-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22161-1-ap","provider":"Iright","version":"1.0","type":"link"}