{"product_id":"proteintech-22165-1-ap","title":"Proteintech, 22165-1-AP, LPAR4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LPAR4 (22165-1-AP) by Proteintech is a Polyclonal antibody targeting LPAR4 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n22165-1-AP targets LPAR4 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SKOV-3 cells, mouse brain tissue,  HL-60 cells,  3T3-L1 cells\nPositive IHC detected in: human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SW 1990 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17817 Product name: Recombinant human LPAR4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 311-370 aa of BC069996 Sequence: YYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELMLESTF Predict reactive species\nFull Name: lysophosphatidic acid receptor 4\nCalculated Molecular Weight: 370 aa, 42 kDa\nObserved Molecular Weight: 42-50 kDa\nGenBank Accession Number: BC069996\nGene Symbol: LPAR4\nGene ID (NCBI): 2846\nRRID: AB_11182491\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99677\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869555347625,"sku":"22165-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22165-1-ap","provider":"Iright","version":"1.0","type":"link"}