{"product_id":"proteintech-22213-1-ap","title":"Proteintech, 22213-1-AP, SOSTDC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SOSTDC1 (22213-1-AP) by Proteintech is a Polyclonal antibody targeting SOSTDC1 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n22213-1-AP targets SOSTDC1 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human milk\nPositive IF\/ICC detected in: Saos-2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSOSTDC1 (Sclerostin domain-containing protein 1), also known as Ectodin (Ectodermal BMP inhibitor), is a member of the sclerostin family. It is an N-glycosylated, secreted protein with a C-terminal cystine knot-like domain and is highly abundant in milk and kidney. This protein functions as a bone morphogenetic protein (BMP) antagonist. Specifically, it directly associates with BMPs, prohibiting them from binding their receptors, thereby regulating BMP signaling during cellular proliferation, differentiation, and programmed cell death.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17538 Product name: Recombinant human SOSTDC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-206 aa of BC008484 Sequence: EILYSHVVKPVPAHPSSNSTLNQARNGGRHFSNTGLDRNTRVQVGCRELRSTKYISDGQCTSISPLKELVCAGECLPLPVLPNWIGGGYGTKYWSRRSSQEWRCVNDKTRTQRIQLQCQDGSTRTYKITVVTACKCKRYTRQHNESSHNFESMSPAKPVQHHRERKRASKSSKHSMS Predict reactive species\nFull Name: sclerostin domain containing 1\nCalculated Molecular Weight: 206 aa, 23 kDa\nObserved Molecular Weight: 23-26 kDa\nGenBank Accession Number: BC008484\nGene Symbol: SOSTDC1\nGene ID (NCBI): 25928\nRRID: AB_3085688\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6X4U4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887812432041,"sku":"22213-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22213-1-ap","provider":"Iright","version":"1.0","type":"link"}