{"product_id":"proteintech-22214-1-ap","title":"Proteintech, 22214-1-AP, ACP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ACP1 (22214-1-AP) by Proteintech is a Polyclonal antibody targeting ACP1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n22214-1-AP targets ACP1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  L02 cells,  mouse brain tissue\nPositive IHC detected in: human breast cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman red cell acid phosphatase (ACP1) is a polymorphic enzyme closely related to cytosolic low molecular weight acid phosphatases, a protein family broadly conserved among eukaryotes. It catalyses the transfer of phosphate from phosphate ester substrates to suitable acceptor alcohols such as methanol and glycerol. This protein has 3 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17539 Product name: Recombinant human ACP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 15-102 aa of BC007422 Sequence: GNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNR Predict reactive species\nFull Name: acid phosphatase 1, soluble\nCalculated Molecular Weight: 158 aa, 18 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: BC007422\nGene Symbol: ACP1\nGene ID (NCBI): 52\nRRID: AB_2879032\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P24666\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869630681257,"sku":"22214-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22214-1-ap","provider":"Iright","version":"1.0","type":"link"}