{"product_id":"proteintech-22220-1-ap","title":"Proteintech, 22220-1-AP, ALDH1B1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ALDH1B1 (22220-1-AP) by Proteintech is a Polyclonal antibody targeting ALDH1B1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n22220-1-AP targets ALDH1B1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  HepG2 cells,  mouse brain tissue,  mouse testis tissue,  rat brain tissue\nPositive IHC detected in: human ovary tumor tissue, human colon cancer tissue,  human liver tissue,  rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAldehyde dehydrogenases (ALDHs) belong to a superfamily of NAD(P)+-dependent enzymes, which catalyze the oxidation of endogenous and exogenous aldehydes to their corresponding acids. ALDH1B1 is a mitochondrial ALDH that it is dramatically upregulated in human colonic adenocarcinoma, making it a potential biomarker for human colon cancer.(PMID:21216231). ALDH1B1 is a homotetramer expressed in various adult and fetal human tissues including liver, testis, kidney, skeletal muscle, heart, placenta, brain and lung(PMID:18611112). This antibody is specific to ALDH1B1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17557 Product name: Recombinant human ALDH1B1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 330-382 aa of BC001619 Sequence: SIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGA Predict reactive species\nFull Name: aldehyde dehydrogenase 1 family, member B1\nCalculated Molecular Weight: 517 aa, 57 kDa\nObserved Molecular Weight: 55-58 kDa\nGenBank Accession Number: BC001619\nGene Symbol: ALDH1B1\nGene ID (NCBI): 219\nRRID: AB_2879035\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P30837\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869513437353,"sku":"22220-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22220-1-ap","provider":"Iright","version":"1.0","type":"link"}