{"product_id":"proteintech-22227-1-ap","title":"Proteintech, 22227-1-AP, CEP164 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CEP164 (22227-1-AP) by Proteintech is a Polyclonal antibody targeting CEP164 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, canine samples\n22227-1-AP targets CEP164 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, canine samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\nPositive IP detected in: RPE1 cells\nPositive IHC detected in: human colon tissue, human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, A549 cells,  PC-3 cells,  MDCK cells,  hTERT-RPE1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:100-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCEP164, also called KIAA1052 or NPHP15, is a 1460 amino acid protein containing 1 WW domain. CEP164 localizes in the microtubule organizing center and is expressed in several cell lines. CEP164 plays a role in microtubule organization and\/or maintenance for the formation of primary cilia, a microtubule-based structure that protrudes from the surface of epithelial cells. CEP164 plays a critical role in the G2\/M checkpoint and nuclear divisions. The expression of CEP164 is normally limited to the mother centriole, and CEP164 can be used as a useful marker for mother centriole.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, canine\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17570 Product name: Recombinant human CEP164 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC000602 Sequence: MAGRPLRIGDQLVLEEDYDETYIPSEQEILEFAREIGIDPIKEPELMWLAREGIVAPLPGEWKPCQDITGDIYYFNFANGQSMWDHPCDEHYRSLVIQERAKLSTSGAIKKK Predict reactive species\nFull Name: centrosomal protein 164kDa\nCalculated Molecular Weight: 1460 aa, 164 kDa\nObserved Molecular Weight: 164 kDa\nGenBank Accession Number: BC000602\nGene Symbol: CEP164\nGene ID (NCBI): 22897\nRRID: AB_2651175\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UPV0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868833632425,"sku":"22227-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22227-1-ap","provider":"Iright","version":"1.0","type":"link"}