{"product_id":"proteintech-22230-1-ap","title":"Proteintech, 22230-1-AP, Cytokeratin 17 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cytokeratin 17 (22230-1-AP) by Proteintech is a Polyclonal antibody targeting Cytokeratin 17 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n22230-1-AP targets Cytokeratin 17 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  MCF-7 cells\nPositive IHC detected in: human bowen disease, human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKeratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. Keratin 17 is a type I cytokeratin. It is found in nail beds, hair follicles, sebaceous glands, and other epidermal appendages. It is used as a marker for trauma.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17575 Product name: Recombinant human KRT17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-87 aa of BC000159 Sequence: MTTSIRQFTSSSSIKGSSGLGGGSSRTSCRLSGGLGAGSCRLGSAGGLGSTLGGSSYSSCYSFGSGGGYGSSFGGVDGLLAGGEKAT Predict reactive species\nFull Name: keratin 17\nCalculated Molecular Weight: 432 aa, 48 kDa\nObserved Molecular Weight: 48 kDa\nGenBank Accession Number: BC000159\nGene Symbol: Cytokeratin 17\nGene ID (NCBI): 3872\nRRID: AB_2879040\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q04695\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887041368233,"sku":"22230-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22230-1-ap","provider":"Iright","version":"1.0","type":"link"}