{"product_id":"proteintech-22234-1-ap","title":"Proteintech, 22234-1-AP, ADAM28 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ADAM28 (22234-1-AP) by Proteintech is a Polyclonal antibody targeting ADAM28 in WB, IP, ELISA applications with reactivity to human, mouse samples\n22234-1-AP targets ADAM28 in WB, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue, BxPC-3 cells,  PC-13 cells,  mouse spleen tissue\nPositive IP detected in: mouse lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nADAM28 belongs to a family of cell surface and secreted glycoproteins that possess both proteolytic and adhesive properties. ADAM28 is predominantly expressed by carcinoma cells in the breast carcinoma tissues as protein bands of 42 kDa and 55\/57 kDa, which correspond to the active forms of ADAM28s and ADAM28m, respectively.In human non-small cell lung carcinomas and breast carcinomas, ADAM28 is overexpressed predominantly by carcinoma cells, and the expression correlates with carcinoma cell proliferation and lymph node metastasis(PMID:19601836).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17586 Product name: Recombinant human ADAM28 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 425-775 aa of BC136478 Sequence: TSEECTNICCDAKTCKIKATFQCALGECCEKCQFKKAGMVCRPAKDECDLPEMCNGKSGNCPDDRFQVNGFPCHHGKGHCLMGTCPTLQEQCTELWGPGTEVADKSCYNRNEGGSKYGYCRRVDDTLIPCKANDTMCGKLFCQGGSDNLPWKGRIVTFLTCKTFDPEDTSQEIGMVANGTKCGDNKVCINAECVDIEKAYKSTNCSSKCKGHAVCDHELQCQCEEGWIPPDCDDSSVVFHFSIVVGVLFPMAVIFVVVAMVIRHQSSREKQKKDQRPLSTTGTRPHKQKRKPQMVKAVQPQEMSQMKPHVYDLPVEGNEPPASFHKDTNALPPTVFKDNPMSTPKDSNPKA Predict reactive species\nFull Name: ADAM metallopeptidase domain 28\nCalculated Molecular Weight: 775 aa, 87 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC136478\nGene Symbol: ADAM28\nGene ID (NCBI): 10863\nRRID: AB_2879043\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UKQ2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868975845545,"sku":"22234-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22234-1-ap","provider":"Iright","version":"1.0","type":"link"}