{"product_id":"proteintech-22236-1-ap","title":"Proteintech, 22236-1-AP, BRD2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BRD2 (22236-1-AP) by Proteintech is a Polyclonal antibody targeting BRD2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n22236-1-AP targets BRD2 in WB, IHC, IF\/ICC, IP, ChIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, J774A. 1 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17589 Product name: Recombinant human BRD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 537-668 aa of BC063840 Sequence: LSQGPISKPKRKREKKEKKKKRKAEKHRGRAGADEDDKGPRAPRPPQPKKSKKASGSGGGSAALGPSGFGPSGGSGTKLQAGVQWRDLGLLQPPLLGFKRFSCLSLPSSQDYRLPKKATKTAPPALPTGYDS Predict reactive species\nFull Name: bromodomain containing 2\nCalculated Molecular Weight: 836 aa, 92 kDa\nObserved Molecular Weight: 100-110 kDa\nGenBank Accession Number: BC063840\nGene Symbol: BRD2\nGene ID (NCBI): 6046\nRRID: AB_2722524\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P25440\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868915814569,"sku":"22236-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22236-1-ap","provider":"Iright","version":"1.0","type":"link"}