{"product_id":"proteintech-22244-1-ap","title":"Proteintech, 22244-1-AP, CALCA\/Calcitonin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CALCA\/Calcitonin (22244-1-AP) by Proteintech is a Polyclonal antibody targeting CALCA\/Calcitonin in WB, IP, ELISA applications with reactivity to human samples\n22244-1-AP targets CALCA\/Calcitonin in WB, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: TT cells, Transfected HEK-293 cells\nPositive IP detected in: TT cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCalcitonin is a peptide hormone consisting of 32 amino acids, primarily synthesized by the parafollicular cells (C cells) of the human thyroid gland. It plays a crucial role in regulating calcium levels in the blood by decreasing them. Calcitonin opposes the actions of parathyroid hormone, which increases blood calcium levels. Calcitonin works through a G protein-coupled receptor, known as the calcitonin receptor, which predominantly transmits signals via the cAMP and PLC\/IP3 pathways. Its primary physiological effects are on osteoclasts and the tubular epithelium of kidneys.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17737 Product name: Recombinant human CALCA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 65-141 aa of BC093753 Sequence: ELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNAN Predict reactive species\nFull Name: Calcitonin\nCalculated Molecular Weight: 141 aa, 15 kDa\nObserved Molecular Weight: 14 kDa, 5 kDa\nGenBank Accession Number: BC093753\nGene Symbol: CALCA\nGene ID (NCBI): 796\nRRID: AB_3669393\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P01258\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869649359017,"sku":"22244-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22244-1-ap","provider":"Iright","version":"1.0","type":"link"}