{"product_id":"proteintech-22248-1-ap","title":"Proteintech, 22248-1-AP, ADARB1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ADARB1 (22248-1-AP) by Proteintech is a Polyclonal antibody targeting ADARB1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n22248-1-AP targets ADARB1 in WB, IHC, IF, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, 4T1 cells,  C2C12 cells,  HeLa cells,  NIH\/3T3 cells,  HepG2 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nADARB1(Double-stranded RNA-specific editase 1) is also named as ADAR2, DRADA2, RED1 and belongs to the ADAR family. It catalyses the deamination of adenosine to inosine at the GluR2 Q\/R site in the pre-mRNA encoding the critical subunit of AMPA receptors. This protein has some isoforms with the molecular weight from 77 kDa to 81 kDa and 7 kDa, but it can be detected a very strong band at 50 kDa in addition to a predicted band at 75 kDa as the result of western blot, while ADARB1 has several alternative splice variants (PMID:23103828).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17743 Product name: Recombinant human ADARB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 176-392 aa of BC065545 Sequence: LFNGFETPDKAEPPFYVGSNGDDSFSSSGDLSLSASPVPASLAQPPLPALPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALAAIFNLHLDQTPSRQPIPSEGLQLHLPQVLADAVSRLVLGKFGDLTDNFSSPHARRKVLAGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLALND Predict reactive species\nFull Name: adenosine deaminase, RNA-specific, B1 (RED1 homolog rat)\nCalculated Molecular Weight: 741 aa, 81 kDa\nObserved Molecular Weight: 74-86 kDa\nGenBank Accession Number: BC065545\nGene Symbol: ADARB1\nGene ID (NCBI): 104\nRRID: AB_2879047\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P78563\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868892745897,"sku":"22248-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22248-1-ap","provider":"Iright","version":"1.0","type":"link"}