{"product_id":"proteintech-22323-1-ap","title":"Proteintech, 22323-1-AP, PBX4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PBX4 (22323-1-AP) by Proteintech is a Polyclonal antibody targeting PBX4 in WB, IP, ELISA applications with reactivity to human samples\n22323-1-AP targets PBX4 in WB, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, SKOV-3 cells,  A2780 cells,  COLO 320 cells,  Jurkat cells\nPositive IP detected in: A2780 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPre-B-cell leukemia homeobox 4 (PBX4), also named as Homeobox protein PBX4, is one of the pbx gene encode homeodomain containing transcriptional regulators that interact with other proteins to control embryogenesis and tumorigenesis. Pbx 4 expression is confined to the testis, especially to spermatocytes in the pachytene stage of the first meiotic prophase. PBX4 may form heterodimers with other homeobox genes (hoxb1b or meis3) to specify different developmental fates during vertebrate embryogenesis (PMID:10679934). The trimeric complex containing Pbx4, Meis3, and Hoxb1b was also formed.  The calculated molecular weight of PBX4 is about 41 kDa, but the molecular weight of heterodimers (PBX4 and hoxb1b) is about 70 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17768 Product name: Recombinant human PBX4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 278-374 aa of BC141859 Sequence: EATIYTGKTAVDTTEVGVPGNHASCLSTPSSGSSGPFPLPSAGDAFLTLRTLASLQPPPGGGCLQSQAQGSWQGATPQPATASPAGDPGSINSSTSN Predict reactive species\nFull Name: pre-B-cell leukemia homeobox 4\nCalculated Molecular Weight: 374 aa, 41 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC141859\nGene Symbol: PBX4\nGene ID (NCBI): 80714\nRRID: AB_2879071\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q9BYU1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887751418025,"sku":"22323-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22323-1-ap","provider":"Iright","version":"1.0","type":"link"}