{"product_id":"proteintech-22336-1-ap","title":"Proteintech, 22336-1-AP, P glycoprotein Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe P glycoprotein (22336-1-AP) by Proteintech is a Polyclonal antibody targeting P glycoprotein in WB, IHC, IP, ELISA applications with reactivity to human samples\n22336-1-AP targets P glycoprotein in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: unboiled HeLa cells, unboiled HepG2 cells\nPositive IP detected in: human placenta tissue\nPositive IHC detected in: human liver cancer tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nABCB1 (also known as P-gp\/ P-glycoprotein, MDR1\/multidrug-resistance 1) is a plasma membrane protein first discovered in multidrug resistant tumor cells. ABCB1 can extrude a large number of medically relevant compounds from cells and causes drug resistance. ABCB1 is expressed in a variety of human cancers as well as normal tissues including brain, and placenta. Overexpression of ABCB1 correlates with a negative prognosis in several types of cancer. For optimal WB detection with 22336-1-AP, we recommend to avoid boiling the sample after lysis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17811 Product name: Recombinant human ABCB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 624-708 aa of BC130424 Sequence: KLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEW Predict reactive species\nFull Name: ATP-binding cassette, sub-family B (MDR\/TAP), member 1\nCalculated Molecular Weight: 1280 aa, 142 kDa\nObserved Molecular Weight: 130-150 kDa\nGenBank Accession Number: BC130424\nGene Symbol: P glycoprotein\nGene ID (NCBI): 5243\nRRID: AB_2833023\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P08183\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868826816681,"sku":"22336-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22336-1-ap","provider":"Iright","version":"1.0","type":"link"}