{"product_id":"proteintech-22381-1-ap","title":"Proteintech, 22381-1-AP, TTI1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TTI1 (22381-1-AP) by Proteintech is a Polyclonal antibody targeting TTI1 in WB, IP, ELISA applications with reactivity to human samples\n22381-1-AP targets TTI1 in WB, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells\nPositive IP detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:5000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTelomere maintenance 2-interacting protein 1 (TTI1), also known as KIAA0406 or SMG10, is one of the members of the conserved Triple T (TTT) complex, which is composed of telo a regulator of DNA damage and repair. TTI1 is expressed in numerous organisms and is assumed to play a central role in regulating a wide spectrum of DNA damage responses, telomere maintenance, and checkpoint signaling (PMID: 20427287). Knockdown of Tti1 suppresses phosphorylation of both mTORC1 substrates (S6K1 and 4E-BP1) and an mTORC2 substrate (Akt) (PMID: 40514657)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17697 Product name: Recombinant human KIAA0406 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 740-1089 aa of BC013755 Sequence: DVLATLDQFYDKRAASFVSVLHALMAALAQWFPDTGNLGHLQEQSLGEEGSHLNQRPAALEKSTTTAEDIEQFLLNYLKEKDVADGNVSDFDNEEEEQSVPPKVDENDTRPDVEPPLPLQIQIAMDVMERCIHLLSDKNLQIRLKVLDVLDLCVVVLQSHKNQLLPLAHQAWPSLVHRLTRDAPLAVLRAFKVLRTLGSKCGDFLRSRFCKDVLPKLAGSLVTQAPISARAGPVYSHTLAFKLQLAVLQGLGPLCERLDLGEGDLNKVADACLIYLSVKQPVKLQEAARSVFLHLMKVDPDSTWFLLNELYCPVQFTPPHPSLHPVQLHGASGQQNPYTTNVLQLLKELQ Predict reactive species\nFull Name: KIAA0406\nCalculated Molecular Weight: 1089 aa, 122 kDa\nObserved Molecular Weight: 120 kDa\nGenBank Accession Number: BC013755\nGene Symbol: TTI1\nGene ID (NCBI): 9675\nRRID: AB_2879094\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: O43156\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869782724777,"sku":"22381-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22381-1-ap","provider":"Iright","version":"1.0","type":"link"}