{"product_id":"proteintech-22433-1-ap","title":"Proteintech, 22433-1-AP, ABLIM2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ABLIM2 (22433-1-AP) by Proteintech is a Polyclonal antibody targeting ABLIM2 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n22433-1-AP targets ABLIM2 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue,  mouse skeletal muscle tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse skeletal muscle tissue, human skeletal muscle tissue,  human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18198 Product name: Recombinant human ABLIM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 282-389 aa of BC122567 Sequence: SIISVPASSTSGSPSRVIYAKLGGEILDYRDLAALPKSKAIYDIDRPDMISYSPYISHSAGDRQSYGEGDQDDRSYKQCRTSSPSSTGSVSLGRYTPTSRSPQHYSRP Predict reactive species\nFull Name: actin binding LIM protein family, member 2\nCalculated Molecular Weight: 611 aa, 68 kDa\nObserved Molecular Weight: 60-70 kDa\nGenBank Accession Number: BC122567\nGene Symbol: ABLIM2\nGene ID (NCBI): 84448\nRRID: AB_11232422\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6H8Q1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869799076009,"sku":"22433-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22433-1-ap","provider":"Iright","version":"1.0","type":"link"}