{"product_id":"proteintech-22463-1-ap","title":"Proteintech, 22463-1-AP, CD1e Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD1e (22463-1-AP) by Proteintech is a Polyclonal antibody targeting CD1e in WB, ELISA applications with reactivity to human samples\n22463-1-AP targets CD1e in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, MOLT-4 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD1e molecule (CD1e, also known as R2 and CD1A) is a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin (PMID: 10948205). The discoverers of the CD1 locus originally separated CD1 proteins into group 1 (CD1a, CD1b, and CD1c) and group 2 (CD1d), based on amino acid sequence homology (PMID: 2467814). CD1e is an important modulator of group 1 and group 2 CD1-restricted responses influencing the lipid antigen availability and the generation and persistence of CD1-lipid complexes (PMID: 21844346).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18008 Product name: Recombinant human CD1E protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-219 aa of BC131693 Sequence: APQALQSYHLAAEEQLSFRMLQTSSFANHSWAHSEGSGWLGDLQTHGWDTVLGTIRFLKPWSHGNFSKQELKNLQSLFQLYFHSFIQIVQASAGQFQLEYPFEIQILAGCRMNAPQIFLNMAYQGSDFLSFQGISWEPSPGAGIRAQNICKVLNRYLDIKEILQSLLGHTCPRFLAGLMEAGESELKRKVKPEAWLSCGP Predict reactive species\nFull Name: CD1e molecule\nCalculated Molecular Weight: 388 aa, 44 kDa\nObserved Molecular Weight: 51 kDa\nGenBank Accession Number: BC131693\nGene Symbol: CD1E\nGene ID (NCBI): 913\nRRID: AB_3669398\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: P15812\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886122750121,"sku":"22463-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22463-1-ap","provider":"Iright","version":"1.0","type":"link"}