{"product_id":"proteintech-22490-1-ap","title":"Proteintech, 22490-1-AP, CEP290 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CEP290 (22490-1-AP) by Proteintech is a Polyclonal antibody targeting CEP290 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n22490-1-AP targets CEP290 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nStudies in the Chlamydomonas model system has shown that the ciliary protein CEP290 is a critical component of these Y-link junctions. Additionally, numerous studies have demonstrated that CEP290's function is critical for IFT-in CEP290 knockdown experiments, many proteins that would normally localize to the cilium fail to do so, and cilium formation is disrupted or absent. Mutations in CEP290 are accountable for cases of nephronophthisis, Leber congenital amaurosis and Joubert syndrome. In IF analtsis of HeLa cells, the white arrows show centrosome and cilium staining. Two isoforms were produced by alternative splicing with predicted MW of 290 and 180 kDa according to UniProt. Catalog#22490-1-AP can recognise both.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17457 Product name: Recombinant human CEP290 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-237 aa of BC008641 Sequence: QMDSDEMKKILAENSRKITVLQVNEKSLIRQYTTLVELERQLRKENEKQKNELLSMEAEVCEKIGCLQRFKEMAIFKIAALQKVVDNSVSLSELELANKQYNELTAKYRDILQKDNMLVQRTSNLEHLECENISLKEQVESINKELEITKEKLHTIEQAWEQETKLGNESSMDKAKKSITNSDIVSISKKITMLEMKELNERQRAEHCQKMYEHLRTSLKQMEERNFELETKFAEV Predict reactive species\nFull Name: centrosomal protein 290kDa\nCalculated Molecular Weight: 2479 aa, 290 kDa\nObserved Molecular Weight: 290 kDa\nGenBank Accession Number: BC008641\nGene Symbol: CEP290\nGene ID (NCBI): 80184\nRRID: AB_10973679\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15078\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868883931305,"sku":"22490-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22490-1-ap","provider":"Iright","version":"1.0","type":"link"}