{"product_id":"proteintech-22496-1-ap","title":"Proteintech, 22496-1-AP, LLGL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LLGL1 (22496-1-AP) by Proteintech is a Polyclonal antibody targeting LLGL1 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n22496-1-AP targets LLGL1 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLethal giant larvae (Lgl) is a scaffolding protein that regulates the establishment of apical-basal polarity in epithelial cells. The human homologs of Lgl are known as LLGL1 and LLGL2. LLGL1 is a tumor suppressor in multiple human cancers, including hepatocellular carcinoma, malignant melanoma, and colorectal cancer (PMID: 34178676; 15735678; 16170365). LLGL2 functions as a promoter of tumor growth and not as a tumor suppressor in ER+ breast cancer (PMID: 30996345).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18057 Product name: Recombinant human LLGL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 67-212 aa of BC151838 Sequence: EFTGLHRDAATVTQMHFLTGQGRLLSLLDDSSLHLWEIVHHNGCAHLEEALSFQLPSRPGFDGASAPLSLTRVTVVLLVAAGDIAALGTEGSSVFFLDVTTLTLLEGQTLAPGEVLRSVPDDYRCGKALGPVESLQGHLRDPTKIL Predict reactive species\nFull Name: lethal giant larvae homolog 1 (Drosophila)\nCalculated Molecular Weight: 1064 aa, 115 kDa\nObserved Molecular Weight: 115 kDa\nGenBank Accession Number: BC151838\nGene Symbol: LLGL1\nGene ID (NCBI): 3996\nRRID: AB_3669400\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q15334\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887704854697,"sku":"22496-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22496-1-ap","provider":"Iright","version":"1.0","type":"link"}