{"product_id":"proteintech-22522-1-ap","title":"Proteintech, 22522-1-AP, HPGDS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HPGDS (22522-1-AP) by Proteintech is a Polyclonal antibody targeting HPGDS in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n22522-1-AP targets HPGDS in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat spleen tissue, mouse small intestine tissue\nPositive IHC detected in: human placenta tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHematopoietic prostaglandin D synthase (HPGDS) is expressed in human Th2 lymphocytes, antigen-presenting cells, mast cells and microglia. HPGDS converts PGH2 into PGD2, a mediator thought to play a pivotal role in airway allergy and inflammatory processes (PMID: 16624958). HPGDS deficiency is a critical factor that impedes cutaneous wound healing in diabetes. Overexpressing Hpgds in ADSCs could be an effective way to accelerate DW healing by alleviating inflammatory cells recruitment and increasing M2 polarization in the proliferation phase (PMID: 35922870). HPGDS is a cytosolic homodimer of 26 kDa subunits which reveal a well-defined active site, enabling a structure-based design of inhibitors (PMID: 24900177).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18290 Product name: Recombinant human PGDS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-199 aa of BC020734 Sequence: MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL Predict reactive species\nFull Name: prostaglandin D2 synthase, hematopoietic\nCalculated Molecular Weight: 199 aa, 23 kDa\nObserved Molecular Weight: 26-30 kDa\nGenBank Accession Number: BC020734\nGene Symbol: HPGDS\nGene ID (NCBI): 27306\nRRID: AB_2879115\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: O60760\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869411659945,"sku":"22522-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22522-1-ap","provider":"Iright","version":"1.0","type":"link"}