{"product_id":"proteintech-22524-1-ap","title":"Proteintech, 22524-1-AP, Dopamine Transporter\/DAT Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Dopamine Transporter\/DAT (22524-1-AP) by Proteintech is a Polyclonal antibody targeting Dopamine Transporter\/DAT in WB, IHC, IF-P, IF-Fro, IP, ELISA applications with reactivity to human, mouse, rat samples\n22524-1-AP targets Dopamine Transporter\/DAT in WB, IHC, IF-P, IF-Fro, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\nPositive IF-Fro detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDAT, also name as SLC6A3, is dopamine transporter which is a member of the sodium- and chloride- dependent neurotransmitter transporter family. Dopamine(DA) released from neurons is cleared by the DA transporter (DAT). Altered dopaminergic signaling is linked to multiple neuropsychiatric disorders, such as attention deficit hyperactive disorder, mood disorders, schizophrenia, autism and so on (PMID:30755521). 22524-1-AP can detect 70~80kDa band, which is consistent with the report (PMID:12746456).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18297 Product name: Recombinant human SLC6A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-62 aa of BC133003 Sequence: MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDRET Predict reactive species\nFull Name: solute carrier family 6 (neurotransmitter transporter, dopamine), member 3\nCalculated Molecular Weight: 620 aa, 68 kDa\nObserved Molecular Weight: 68 kDa\nGenBank Accession Number: BC133003\nGene Symbol: DAT\nGene ID (NCBI): 6531\nRRID: AB_2879116\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q01959\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868837466281,"sku":"22524-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22524-1-ap","provider":"Iright","version":"1.0","type":"link"}