{"product_id":"proteintech-22601-1-ap","title":"Proteintech, 22601-1-AP, VEGF-C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VEGF-C (22601-1-AP) by Proteintech is a Polyclonal antibody targeting VEGF-C in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n22601-1-AP targets VEGF-C in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, RAW 264.7 cells,  HCT 116 cells,  SW480 cells\nPositive IHC detected in: human prostate cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: RAW 264.7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVEGFC is a member of the platelet-derived growth factor \/ vascular endothelial growth factor (PDGF\/VEGF) family. The main function of VEGFC is to promote the growth of lymphatic vessels (lymphangiogenesis). It acts on lymphatic endothelial cells (LECs) primarily via its receptor VEGFR-3 promoting survival, growth, and migration.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18182 Product name: Recombinant human VEGFC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 179-228 aa of BC035212 Sequence: SYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRS Predict reactive species\nFull Name: vascular endothelial growth factor C\nCalculated Molecular Weight: 419 aa, 47 kDa\nObserved Molecular Weight: 47 kDa\nGenBank Accession Number: BC035212\nGene Symbol: VEGFC\nGene ID (NCBI): 7424\nRRID: AB_2879132\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P49767\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868847853737,"sku":"22601-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22601-1-ap","provider":"Iright","version":"1.0","type":"link"}