{"product_id":"proteintech-22722-1-ap","title":"Proteintech, 22722-1-AP, WHSC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WHSC1 (22722-1-AP) by Proteintech is a Polyclonal antibody targeting WHSC1 in WB, IP, IHC, ELISA applications with reactivity to human samples\n22722-1-AP targets WHSC1 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWHSC1 (also known as MMSET or NSD2) is a SET domain containing histone lysine methyltransferase that can di- and trimethylate histone H3 at lysine 36 (H3K36). WHSC1 mRNA is highly expressed in embryonic tissues, especially those with high degrees of proliferation, whereas in adult tissues,the mRNA is primarily expressed in thymus and testis. WHSC1 is implicated in cellular adhesion, clonogenic growth and tumorigenicity. Its overexpression has been found in various cancers. It undergoes alternative splicing resulting in different protein isoforms. Recently WHSC1 has been identified as a critical epigenetic regulator for Tfh differentiation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18611 Product name: Recombinant human WHSC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 553-712 aa of BC152412 Sequence: RPKTSTTLSSEEKGKKTKKKTRRRRAKGEGKRQSEDECFRCGDGGQLVLCDRKFCTKAYHLSCLGLGKRPFGKWECPWHHCDVCGKPSTSFCHLCPNSFCKEHQDGTAFSCTPDGRSYCCEHDLGAASVRSTKTEKPPPEPGKPKGKRRRRRGWRRVTEG Predict reactive species\nFull Name: Wolf-Hirschhorn syndrome candidate 1\nCalculated Molecular Weight: 162 kDa\nObserved Molecular Weight: 70 kDa, 150 kDa\nGenBank Accession Number: BC152412\nGene Symbol: WHSC1\nGene ID (NCBI): 7468\nRRID: AB_2879156\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: O96028\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869793505449,"sku":"22722-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22722-1-ap","provider":"Iright","version":"1.0","type":"link"}