{"product_id":"proteintech-22762-1-ap","title":"Proteintech, 22762-1-AP, SARDH Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SARDH (22762-1-AP) by Proteintech is a Polyclonal antibody targeting SARDH in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n22762-1-AP targets SARDH in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, rat liver tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSARDH is a mitochondrial flavoenzyme that oxidizes sarcosine to glycine, feeding one-carbon units into folate metabolism. By tuning methyl-group balance, it modulates epigenetic programs and immune fate. Silencing or mutation of SARDH drives sarcosine accumulation, fueling invasion in prostate, liver, breast and kidney cancers, whereas its high expression predicts favorable prognosis. Thus SARDH acts as a metabolic tumor-suppressor and an emerging therapeutic target. (PMID: 23824605; 40830700; 31545450)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18738 Product name: Recombinant human SARDH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 309-430 aa of BC136364 Sequence: NVRDHDASVYLRLQGDALSVGGYEANPIFWEEVSDKFAFGLFDLDWEVFTQHIEGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGEAPELRGFFLGCGFNSAGMMLGGGCGQELAHWIIH Predict reactive species\nFull Name: sarcosine dehydrogenase\nCalculated Molecular Weight: 918 aa, 101 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC136364\nGene Symbol: SARDH\nGene ID (NCBI): 1757\nRRID: AB_2879162\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UL12\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869428764841,"sku":"22762-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22762-1-ap","provider":"Iright","version":"1.0","type":"link"}