{"product_id":"proteintech-22792-1-ap","title":"Proteintech, 22792-1-AP, SPAST Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPAST (22792-1-AP) by Proteintech is a Polyclonal antibody targeting SPAST in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n22792-1-AP targets SPAST in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, PC-3 cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPAST encodes a microtubule-severing protein called spastin. By severing microtubules into small segments, SPAST participates in the growth and regeneration of neurites. Mutations in the SPAST gene (previously known as SPG4) are the most common causes of hereditary spastic paraplegia (HSP-SPG4). Mammalian cells express at least two spastin isoforms, a less-abundant full-length form (M1-spastin, 68 kDa) and a more highly expressed isoform (M87-spastin, 60 kDa) that lacks the N-terminal 86 amino acids of the full-length protein. Also, there are two additional 64 kDa and 55 kDa isoforms due to alternative splicing of SPG4 exon 4. This antibody recognizes all these isoforms of spastin.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18797 Product name: Recombinant human SPAST protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 79-278 aa of BC150260 Sequence: CQRFSRALMAAKRSSGAAPAPASASAPAPVPGGEAERVRVFHKQAFEYISIALRIDEDEKAGQKEQAVEWYKKGIEELEKGIAVIVTGQGEQCERARRLQAKMMTNLVMAKDRLQLLESGAVPKRKDPLTHTSNSLPRSKTVMKTGSAGLSGHHRAPSYSGLSMVSGVKQGSGPAPTTHKGTPKTNRTNKPSTPTTATRK Predict reactive species\nFull Name: spastin\nCalculated Molecular Weight: 616 aa, 67 kDa\nObserved Molecular Weight: 52 kDa\nGenBank Accession Number: BC150260\nGene Symbol: SPAST\nGene ID (NCBI): 6683\nRRID: AB_2879170\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UBP0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869431910569,"sku":"22792-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22792-1-ap","provider":"Iright","version":"1.0","type":"link"}