{"product_id":"proteintech-22862-1-ap","title":"Proteintech, 22862-1-AP, ACSM2A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ACSM2A (22862-1-AP) by Proteintech is a Polyclonal antibody targeting ACSM2A in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n22862-1-AP targets ACSM2A in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, human brain tissue,  rat liver tissue,  mouse kidney tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nACSM2A(Acyl-coenzyme A synthetase ACSM2A, mitochondrial) is also named as ACSM2, MACS2 and belongs to the ATP-dependent AMP-binding enzyme family. It acts as a medium-chain fatty acid : CoA ligase with the caculated molecular weight of 64 kDa and acts on acids from C(4) to C(11) and on the corresponding 3-hydroxy- and 2,3- or 3,4-unsaturated acids.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18856 Product name: Recombinant human ACSM2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 223-390 aa of BC125176 Sequence: GTSGLPKMAEHSYSSLGLKAKMDAGWTGLQASDIMWTISDTGWILNILCSLMEPWALGACTFVHLLPKFDPLVILKTLSSYPIKSMMGAPIVYRMLLQQDLSSYKFPHLQNCVTVGESLLPETLENWRAQTGLDIRESYGQTETGLTCMVSKTMKIKPGYMGTAASCY Predict reactive species\nFull Name: acyl-CoA synthetase medium-chain family member 2A\nCalculated Molecular Weight: 577 aa, 64 kDa\nObserved Molecular Weight: 60-64 kDa\nGenBank Accession Number: BC125176\nGene Symbol: ACSM2A\nGene ID (NCBI): 123876\nRRID: AB_2879181\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q08AH3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869442691241,"sku":"22862-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22862-1-ap","provider":"Iright","version":"1.0","type":"link"}