{"product_id":"proteintech-22915-1-ap","title":"Proteintech, 22915-1-AP, Caspase 1\/P20 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Caspase 1\/P20 (22915-1-AP) by Proteintech is a Polyclonal antibody targeting Caspase 1\/P20 in WB, IHC, IF, ELISA applications with reactivity to human samples\n22915-1-AP targets Caspase 1\/P20 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells, HepG2 cells,  THP-1 cells,  U-937 cells,  PC-12 cells\nPositive IHC detected in: human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:100-1:400\nImmunofluorescence (IF): IF : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCASP1(caspase-1) is also named as IL1BC, IL1BCE and belongs to the peptidase C14A family. It is a cysteine protease that regulates inflammatory processes through its capacity to process and activate the interleukin-1-beta (IL1B), IL18, and IL33 precursor proteins. The active caspase-1 can increase cellular membrane permeability and intracellular calcium levels, which facilitates lysosome exocytosis and release of host antimicrobial factors and microbial products (PMID:21804020). It has 5 isoforms produced by alternative splicing. 22915-1-AP can recognize p45 procaspase and the mature fragment p20.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, pig, rabbit, canine, monkey, chicken, hamster, duck\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11143 Product name: Recombinant human Caspase 1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-311 aa of BC062327 Sequence: MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH Predict reactive species\nFull Name: caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase)\nCalculated Molecular Weight: 404 aa, 45 kDa\nObserved Molecular Weight: 45-47 kDa, 30 kDa, 35 kDa\nGenBank Accession Number: BC062327\nGene Symbol: Caspase 1\nGene ID (NCBI): 834\nRRID: AB_2876874\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P29466\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868817084585,"sku":"22915-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22915-1-ap","provider":"Iright","version":"1.0","type":"link"}