{"product_id":"proteintech-22980-1-ap","title":"Proteintech, 22980-1-AP, PRODH Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PRODH (22980-1-AP) by Proteintech is a Polyclonal antibody targeting PRODH in WB, IHC, ELISA applications with reactivity to human,  mouse, rat samples\n22980-1-AP targets PRODH in WB, IHC, IF, ELISA applications and shows reactivity with human,  mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, A549 cells,  rat liver tissue\nPositive IHC detected in: human cerebellum tissue, human liver cancer tissue,  human breast cancer tissue,  human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPRODH(Proline dehydrogenase 1, mitochondrial) is also named as PIG6, HSPOX2, PRODH1, PRODH2, POX, SCZD4, TP53I6 and belongs to the proline oxidase family. It is an oxidoreductase involved in the transfer of redox potential across the mitochondrial membrane and catalyzes the rate-limiting oxidation of proline to pyrroline- 5-carboxylate (P5C). High PRODH activity is sufficient to induce mitochondria-mediated apoptosis in the presence of proline. Defects in PRODH are the cause of hyperprolinemia type 1 (HP-1) and defects in PRODH are associated with susceptibility to schizophrenia type 4 (SCZD4). This protein has 3 isoforms produced by alternative splicing with the molecular mass of 68 kDa, 59 kDa and 56 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18429 Product name: Recombinant human PRODH protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 143-492 aa of BC118597 Sequence: LAKWRCFFHQMAVEQGQAGLAAMDTKLEVAVLQESVAKLGIASRAEIEDWFTAETLGVSGTMDLLDWSSLIDSRTKLSKHLVVPNAQTGQLEPLLSRFTEEEELQMTRMLQRMDVLAKKATEMGVRLMVDAEQTYFQPAISRLTLEMQRKFNVEKPLIFNTYQCYLKDAYDNVTLDVELARREGWCFGAKLVRGAYLAQERARAAEIGYEDPINPTYEATNAMYHRCLDYVLEELKHNAKAKVMVASHNEDTVRFALRRMEELGLHPADHRVYFGQLLGMCDQISFPLGQAGYPVYKYVPYGPVMEVLPYLSRRALENSSLMKGTHRERQLLWLELLRRLRTGNLFHRPA Predict reactive species\nFull Name: proline dehydrogenase (oxidase) 1\nCalculated Molecular Weight: 600 aa, 68 kDa\nObserved Molecular Weight: 56 kDa, 66 kDa\nGenBank Accession Number: BC118597\nGene Symbol: PRODH\nGene ID (NCBI): 5625\nRRID: AB_2879191\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43272\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868903493801,"sku":"22980-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-22980-1-ap","provider":"Iright","version":"1.0","type":"link"}