{"product_id":"proteintech-23001-1-ap","title":"Proteintech, 23001-1-AP, GBP6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GBP6 (23001-1-AP) by Proteintech is a Polyclonal antibody targeting GBP6 in WB, IHC, ELISA applications with reactivity to human samples\n23001-1-AP targets GBP6 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells\nPositive IHC detected in: human testis tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGuanylate-binding protein 6 (GBP6) is a member of the guanylate-binding protein family and is best known as a gene induced by interferon-γ signalling. Interferon-γ is produced predominantly by NK and T-cells, indicating that GBP6 is involved in host immune response (PMID: 28747659, 27029383). GBP6 has 2 isoforms with the molecular mass of 34 and 72 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19196 Product name: Recombinant human GBP6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 530-633 aa of BC131713 Sequence: LKEKLQMEREHLLREQIMMLEHTQKVQNDWLHEGFKKKYEEMNAEISQFKRMIDTTKNDDTPWIARTLDNLADELTAILSAPAKLIGHGVKGVSSLFKKHKLPF Predict reactive species\nFull Name: guanylate binding protein family, member 6\nCalculated Molecular Weight: 633 aa, 72 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC131713\nGene Symbol: GBP6\nGene ID (NCBI): 163351\nRRID: AB_2879195\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q6ZN66\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869544206505,"sku":"23001-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-23001-1-ap","provider":"Iright","version":"1.0","type":"link"}