{"product_id":"proteintech-23002-1-ap","title":"Proteintech, 23002-1-AP, SORCS1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SORCS1 (23002-1-AP) by Proteintech is a Polyclonal antibody targeting SORCS1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n23002-1-AP targets SORCS1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, Y79 cells\nPositive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSORCS1, also named as SorCS, belongs to the family of VPS10 domain-containing receptors. SorCS1 immunoreactivity is widespread in a population of neurons throughout the brain. Two different types of cellular localization were observed. Most SorCS1 immunoreactive neurons exhibit a punctate cytoplasmic staining which extends into the dendrites, whilst occassionally SorCS1 neuronal immunoreactivity is associated with the plasma membrane.The predicted molecular weight (MW) of SORCS1 is 130 kDa, and the 60-80 kDa bands observed may represent degradation products.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19199 Product name: Recombinant human SORCS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 33-156 aa of BC131597 Sequence: GGGSCCPSPHPSSAPRSASTPRGFSHQGRPGRAPATPLPLVVRPLFSVAPGDRALSLERARGTGASMAVAARSGRRRRSGADQEKAERGEGASRSPRGVLRDGGQQEPGTRERDPDKATRFRME Predict reactive species\nFull Name: sortilin-related VPS10 domain containing receptor 1\nCalculated Molecular Weight: 1168 aa, 130 kDa\nGenBank Accession Number: BC131597\nGene Symbol: SORCS1\nGene ID (NCBI): 114815\nRRID: AB_2879196\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q8WY21\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869770010793,"sku":"23002-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-23002-1-ap","provider":"Iright","version":"1.0","type":"link"}