{"product_id":"proteintech-23082-1-ap","title":"Proteintech, 23082-1-AP, Alpha cardiac muscle actin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Alpha cardiac muscle actin (23082-1-AP) by Proteintech is a Polyclonal antibody targeting Alpha cardiac muscle actin in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n23082-1-AP targets Alpha cardiac muscle actin in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue\nPositive IHC detected in: human normal colon, human colon tissue,  human heart tissue,  human skeletal muscle tissue,  human small intestine tissue,  mouse skeletal muscle tissue,  mouse heart tissue,  mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: C2C12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:200-1:1000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19482 Product name: Recombinant human ACTC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC009978 Sequence: MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG Predict reactive species\nFull Name: actin, alpha, cardiac muscle 1\nCalculated Molecular Weight: 377 aa, 42 kDa\nObserved Molecular Weight: 42-45 kDa\nGenBank Accession Number: BC009978\nGene Symbol: ACTC1\nGene ID (NCBI): 70\nRRID: AB_2879206\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P68032\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869634547881,"sku":"23082-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-23082-1-ap","provider":"Iright","version":"1.0","type":"link"}