{"product_id":"proteintech-23092-1-ap","title":"Proteintech, 23092-1-AP, NCOA7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NCOA7 (23092-1-AP) by Proteintech is a Polyclonal antibody targeting NCOA7 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n23092-1-AP targets NCOA7 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, MCF-7 cells,  MDA-MB-453 cells,  mouse brain tissue,  rat brain tissue\nPositive IP detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNuclear receptors for steroids, thyroid hormones and retinoic acids are ligand-dependent transcription factors that activate transcription through specific DNA binding sites in their target genes. NCoA-7 (nuclear receptor coactivator 7), also known as ESNA1 or ERAP140, is a 942 amino acid nuclear protein that enhances nuclear receptor transcriptional activities and coactivates several nuclear receptors including PPARG, ESR1, THRB and RARA. Highly expressed in brain and weakly expressed in pancreas, bladder, ovary, spinal cord, prostate, mammary gland, ovary, uterus and stomach, NCoA-7 is a member of the OXR1 family and contains one LysM repeat and a TLD domain. This antibody is a rabbit polyclonal antibody raised against the N-terminal of human NCOA7 protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19315 Product name: Recombinant human NCOA7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC137094 Sequence: MDTKEEKKERKQSYFARLKKKKQAKQNAETASAVATRTHTGKEDNNTVVLEPDKCNIAVEEEYMTDEKKKRKSNQLKEIRRTELKRYYSIDDNQNKTHDKKEKKMVVQKPHGTMEYTAGNQDTLNSIALKFNITPNKLVELNKLFTHTIVPGQVLFVPDANSPSSTLRLSSSSPGATVSPSSSDAEYDKLPDADLARKALKPIERVLSSTSEEDEPGVVKFLKMNCRYFTDGKGVVGGVMIVTPNNIMFDPHKSDPLVIENGCEEYGLICPMEEVVSIALYNDISHMKIKDALPSDLPQDLCPLYRPGEWEDLASEKDINPFSKFKSINKEKRQQNGEKIMTSDSRPIVP Predict reactive species\nFull Name: nuclear receptor coactivator 7\nCalculated Molecular Weight: 972 aa, 106 kDa\nObserved Molecular Weight: 120-130 kDa\nGenBank Accession Number: BC137094\nGene Symbol: NCOA7\nGene ID (NCBI): 135112\nRRID: AB_2879208\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NI08\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868985020585,"sku":"23092-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-23092-1-ap","provider":"Iright","version":"1.0","type":"link"}