{"product_id":"proteintech-23168-1-ap","title":"Proteintech, 23168-1-AP, AFAF\/EQTN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AFAF\/EQTN (23168-1-AP) by Proteintech is a Polyclonal antibody targeting AFAF\/EQTN in WB, IF\/ICC, ELISA applications with reactivity to human samples\n23168-1-AP targets AFAF\/EQTN in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells,  HeLa cells\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe AFAF gene (also known as EQTN and C9orf11) encodes a membrane protein that is specifically localized to the acrosomal membrane. AFAF is involved in the process of fertilization and acrosome biogenesis. Expression analysis demonstrates that AFAF is highly expressed in the testis, although minor expression was seen in other tissues. AFAF has 3 isoforms with molecular weights of 14, 29, and 33 kDa. However, one article detected molecular weight between 40-65 kDa in mouse testis (PMID: 19605790).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19656 Product name: Recombinant human C9orf11 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 20-121 aa of BC137351 Sequence: LKPTIEALPNVLPLNEDVNKQEEKNEDHTPNYAPANEKNGNYYKDIKQYVFTTQNPNGTESEISVRATTDLNFALKNDKTVNATTYEKSTIEEETTTSEPSH Predict reactive species\nFull Name: chromosome 9 open reading frame 11\nCalculated Molecular Weight: 294 aa, 33 kDa\nObserved Molecular Weight: 27-29 kDa\nGenBank Accession Number: BC137351\nGene Symbol: AFAF\nGene ID (NCBI): 54586\nRRID: AB_2879222\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NQ60\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869804417193,"sku":"23168-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-23168-1-ap","provider":"Iright","version":"1.0","type":"link"}