{"product_id":"proteintech-23254-1-ap","title":"Proteintech, 23254-1-AP, IDH2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IDH2 (23254-1-AP) by Proteintech is a Polyclonal antibody targeting IDH2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human,  mouse,  rat samples\n23254-1-AP targets IDH2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells,  mouse kidney tissue,  mouse liver tissue,  rat kidney tissue,  rat liver tissue,  DU 145 cells,  Jurkat cells,  mouse brain tissue\nPositive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIDH2, also named as IDP and ICD-M, belongs to the isocitrate and isopropylmalate dehydrogenases family. It plays a role in intermediary metabolism and energy production. IDH2 is a mitochondrial NADP-dependent isocitrate dehydrogenase that catalyzes oxidative decarboxylation of isocitrate to alpha-ketoglutarate, producing NADPH. It may tightly associate or interact with the pyruvate dehydrogenase complex. IDH1 and IDH2 mutations could also contribute to tumorigenesis and cancer progression through increased mutagenesis. IDH2 has 2 isoforms with the MW of 51 kDa and 45 kDa, and the mature form is about 47 kDa and 41 kDa with the N-terminal transit peptide cleaved. This antibody is specific to IDH2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19748 Product name: Recombinant human IDH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 394-452 aa of BC009244 Sequence: FAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ Predict reactive species\nFull Name: isocitrate dehydrogenase 2 (NADP+), mitochondrial\nCalculated Molecular Weight: 452 aa, 51 kDa\nObserved Molecular Weight: 41-47 kDa\nGenBank Accession Number: BC009244\nGene Symbol: IDH2\nGene ID (NCBI): 3418\nRRID: AB_2879241\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P48735\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869550006441,"sku":"23254-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-23254-1-ap","provider":"Iright","version":"1.0","type":"link"}