{"product_id":"proteintech-23301-1-ap","title":"Proteintech, 23301-1-AP, UPF3B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UPF3B (23301-1-AP) by Proteintech is a Polyclonal antibody targeting UPF3B in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n23301-1-AP targets UPF3B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  K-562 cells,  Jurkat cells,  mouse brain tissue\nPositive IHC detected in: human ovary tumor tissue, human skeletal muscle tissue,  human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRegulator of nonsense transcripts 3B (UPF3B) is also named as RENT3B, and belongs to the RENT3 family. UPF3B is a core junction protein in the Nonsense-mediated RNA decay (NMD) pathway, involved in the exonuclear transport and quality supervision of mRNA. And UPF3B showed heightened expression in hepatocellular carcinoma (HCC) tissues and was linked with adverse prognosis (PMID: 38889220). UPF3B promotes the dissociation of post-termination ribosomal complexes that lack nascent peptide. UPF3B could promote ribosome recycling, and UPF3B serves as a direct regulator of translation termination (PMID: 29333258).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18568 Product name: Recombinant human UPF3B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 288-470 aa of BC121017 Sequence: AKKLDKENLSDERASGQSCTLPKRSDSELKDEKPKRPEDESGRDYREREREYERDQEHILRERERLKRQEEERRRQKERYEKEKTFKRKEEEMKKEKDTLRDKGKKAESTESIGSSEKTEKKEEVVKRDRIRNKDRPAMQLYQPGARSRNRLCPPDDSTKSGDSAAERKQESGISHRKEGGEE Predict reactive species\nFull Name: UPF3 regulator of nonsense transcripts homolog B (yeast)\nCalculated Molecular Weight: 483 aa, 58 kDa\nObserved Molecular Weight: 58 kDa\nGenBank Accession Number: BC121017\nGene Symbol: UPF3B\nGene ID (NCBI): 65109\nRRID: AB_2879249\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BZI7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869625766057,"sku":"23301-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-23301-1-ap","provider":"Iright","version":"1.0","type":"link"}