{"product_id":"proteintech-23308-1-ap","title":"Proteintech, 23308-1-AP, BCMO1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BCMO1 (23308-1-AP) by Proteintech is a Polyclonal antibody targeting BCMO1 in WB, IHC, ELISA applications with reactivity to human,   mouse samples\n23308-1-AP targets BCMO1 in WB, IHC, IF, ELISA applications and shows reactivity with human,   mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells,  mouse colon tissue\nPositive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBCMO1(Beta,beta-carotene 15,15'-monooxygenase) is also named as BCDO, BCDO1 and belongs to the carotenoid oxygenase family.The human BCMO1 cDNA encodes a 63-kDa protein with homologies to members of a large and diverse family of polyene chain oxidases and carotenoid cleavage enzymes.Although BCMO1 can be detected in several tissues, its expression is most pronounced in intestinal mucosa and liver(PMID:16504037).It catalyzes the central cleavage of β-carotene to all-trans retinal and is the key enzyme in the intestinal metabolism of carotenes to vitamin A.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19732 Product name: Recombinant human BCMO1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 199-547 aa of BC126210 Sequence: FKIPATVPEGKKQGKSPWKHTEVFCSIPSRSLLSPSYYHSFGVTENYVIFLEQPFRLDILKMATAYIRSMSWASCLAFHREEKTYIHIIDQRTRQPVQTKFYTDAMVVFHHVNAYEEDGCIVFDVIAYEDNSLYQLFYLANLNQDFKENSRLTSVPTLRRFAVPLHVDKNAEVGTNLIKVASTTATALKEEDGQVYCQPEFLYEGLELPRVNYAHNGKQYRYVFATGVQWSPIPTKIIKYDILTKSSLKWREDDCWPAEPLFVPAPGAKDEDDGVILSAIVSTDPQKLPFLLILDAKSFTELARASVDVDMHMDLHGLFITDMDWDTKKQAASEEQRDRASDCHGAPLT Predict reactive species\nFull Name: beta-carotene 15,15'-monooxygenase 1\nCalculated Molecular Weight: 547 aa, 63 kDa\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: BC126210\nGene Symbol: BCMO1\nGene ID (NCBI): 53630\nRRID: AB_2879252\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HAY6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869642608809,"sku":"23308-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-23308-1-ap","provider":"Iright","version":"1.0","type":"link"}