{"product_id":"proteintech-23337-1-ap","title":"Proteintech, 23337-1-AP, C16orf84 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C16orf84 (23337-1-AP) by Proteintech is a Polyclonal antibody targeting C16orf84 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n23337-1-AP targets C16orf84 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells,  mouse liver tissue,  mouse spleen tissue,  Raji cells\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human testis tissue,  human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCytoplasmic tRNA 2-thiolation protein 2 (CUT2), also named as C16orf84 or NCS2, is a 515 amino acid protein, which belongs to the CUT2 family. C16orf84 localizes in the cytoplasm and Plays a central role in 2-thiolation of mcm5S2U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). C16orf84 may act by forming a heterodimer with CTU1\/ATPBD3 that ligates sulfur from thio-carboxylated URM1 onto the uridine of tRNAs at wobble position.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18428 Product name: Recombinant human C16orf84 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 165-515 aa of BC125269 Sequence: QELVGSEGAYKAAVDSFLQQQHVLGAGGGPGPTQGEEQPPQPPLDPQNLARPPAPAQTEALSQLFCSVRTLTAKEELLQTLRTHLILHMARAHGYSKVMTGDSCTRLAIKLMTNLALGRGAFLAWDTGFSDERHGDVVVVRPMRDHTLKEVAFYNRLFSVPSVFTPAVDTKAPEKASIHRLMEAFILRLQTQFPSTVSTVYRTSEKLVKGPRDGPAAGDSGPRCLLCMCALDVDAADSATAFGAQTSSRLSQMQSPIPLTETRTPPGPCCSPGVGWAQRCGQGACRREDPQACIEEQLCYSCRVNMKDLPSLDPLPPYILAEAQLRTQRAWGLQEIRDCLIEDSDDEAGQS Predict reactive species\nFull Name: chromosome 16 open reading frame 84\nCalculated Molecular Weight: 515 aa, 56 kDa\nObserved Molecular Weight: 65-68 kDa\nGenBank Accession Number: BC125269\nGene Symbol: C16orf84\nGene ID (NCBI): 348180\nRRID: AB_2879257\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q2VPK5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885473157289,"sku":"23337-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-23337-1-ap","provider":"Iright","version":"1.0","type":"link"}