{"product_id":"proteintech-23395-1-ap","title":"Proteintech, 23395-1-AP, PIAS1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PIAS1 (23395-1-AP) by Proteintech is a Polyclonal antibody targeting PIAS1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n23395-1-AP targets PIAS1 in WB, IHC, IF, IP, coIP, ChIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, Jurkat cells,  L02 cells,  J774A.1 cells,  RAW 264.7 cells\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18132 Product name: Recombinant human PIAS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 475-651 aa of BC121797 Sequence: PSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTSLPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISLD Predict reactive species\nFull Name: protein inhibitor of activated STAT, 1\nCalculated Molecular Weight: 651 aa, 72 kDa\nObserved Molecular Weight: 72 kDa\nGenBank Accession Number: BC121797\nGene Symbol: PIAS1\nGene ID (NCBI): 8554\nRRID: AB_2879272\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75925\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868907819177,"sku":"23395-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-23395-1-ap","provider":"Iright","version":"1.0","type":"link"}