{"product_id":"proteintech-23443-1-ap","title":"Proteintech, 23443-1-AP, KHDC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KHDC1 (23443-1-AP) by Proteintech is a Polyclonal antibody targeting KHDC1 in WB, IHC, ELISA applications with reactivity to human samples\n23443-1-AP targets KHDC1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells\nPositive IHC detected in: human stomach cancer tissue, human liver tissue,  human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKHDC1, also named as C6orf148, belongs to the KHDC1 family. KHDC1 has two isoforms with calculated MW 27 kDa and 18 kDa. It's a membrane protein. We got 35-40 kDa in our WB detection.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20115 Product name: Recombinant human KHDC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 201-237 aa of BC022080 Sequence: DLSLAPRISGTVCLSVPQPSPYQVIGCSGFHLSSLYP Predict reactive species\nFull Name: KH homology domain containing 1\nCalculated Molecular Weight: 237 aa, 27 kDa\nObserved Molecular Weight: 35-40 kDa\nGenBank Accession Number: BC022080\nGene Symbol: KHDC1\nGene ID (NCBI): 80759\nRRID: AB_2879280\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q4VXA5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887694237865,"sku":"23443-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-23443-1-ap","provider":"Iright","version":"1.0","type":"link"}