{"product_id":"proteintech-23501-1-ap","title":"Proteintech, 23501-1-AP, Mammaglobin A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Mammaglobin A (23501-1-AP) by Proteintech is a Polyclonal antibody targeting Mammaglobin A in WB, IHC, ELISA applications with reactivity to human samples\n23501-1-AP targets Mammaglobin A in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSCGB2A2, also known as mammaglobin A, is a member of the secretoglobin superfamily. It is a breast cancer-associated antigen almost exclusively over-expressed in primary and metastatic human breast cancers, making it a specific molecular marker and a potential therapeutic target for breast cancer. SCGB2A2 is a 93-amino acid protein with a calculated molecular weight of 10.5 kDa. This polyclonal antibody is raised against the C-terminal 71 amino acids of the protein encoded by a cDNA (MGC:71974; BC067220).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20122 Product name: Recombinant human SCGB2A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-120 aa of BC067220 Sequence: IDDNATTNAIDELKECFLNQTDETLSNVEVFMVISFSSYKLFKSPDQGQVGSSFLTDNAKATSEQAFSYIG Predict reactive species\nFull Name: secretoglobin, family 2A, member 2\nCalculated Molecular Weight: 120 aa, 13 kDa\nObserved Molecular Weight: 6-10 kDa\nGenBank Accession Number: BC067220\nGene Symbol: Mammaglobin A\nGene ID (NCBI): 4250\nRRID: AB_2879289\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13296\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869706703017,"sku":"23501-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-23501-1-ap","provider":"Iright","version":"1.0","type":"link"}