{"product_id":"proteintech-23546-1-ap","title":"Proteintech, 23546-1-AP, Retinal S antigen Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Retinal S antigen (23546-1-AP) by Proteintech is a Polyclonal antibody targeting Retinal S antigen in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n23546-1-AP targets Retinal S antigen in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse eye tissue\nPositive IF-P detected in: rat eye tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20318 Product name: Recombinant human SAG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 332-405 aa of BC156656 Sequence: QIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE Predict reactive species\nFull Name: S-antigen; retina and pineal gland (arrestin)\nCalculated Molecular Weight: 405 aa, 45 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC156656\nGene Symbol: Retinal S antigen\nGene ID (NCBI): 6295\nRRID: AB_2879294\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P10523\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887782908073,"sku":"23546-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-23546-1-ap","provider":"Iright","version":"1.0","type":"link"}