{"product_id":"proteintech-23549-1-ap","title":"Proteintech, 23549-1-AP, KGA\/GAM\/GAC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KGA\/GAM\/GAC (23549-1-AP) by Proteintech is a Polyclonal antibody targeting KGA\/GAM\/GAC in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human,  mouse,  rat samples\n23549-1-AP targets KGA\/GAM\/GAC in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells,  HeLa cells,  mouse brain tissue,  mouse liver tissue,  rat brain tissue\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human kidney tissue,  human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGLS, also named as GLS1 and KIAA0838, belongs to the glutaminase family. It catalyzes the first reaction in the primary pathway for the renal catabolism of glutamine. Glutaminase-, glutamate-, and taurine-immunoreactive neurons develop neurofibrillary tangles in Alzheimer's disease.The glutaminase band in AA\/C1 cells is more intense than in HT29 cells, in accordance with measurements of glutaminase activity, and had the same molecular mass of approx. 63 kDa(PMID:12408749). Ping Gao et al. (2009) determined that mitochondrial glutaminase expression (GLS, molecular mass of ~58 kDa) is increased ~10-fold in response to Myc. It also reveals a molecular weight of 83-84 kDa as a phosphate-dependent glutaminase(PMID:447624;7512428). GLS has 3 isoforms produced by alternative splicing and this antibody can recognize all the 3 isoforms(KGA,GAM,GAC) of GLS.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20354 Product name: Recombinant human GLS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-140 aa of BC038507 Sequence: MMRLRGSGMLRDLLLRSPAGVSATLRRAQPLVTLCRRPRGGGRPAAGPAAAARLHPWWGGGGWPAEPLARGLSSSPSEILQELGKGSTHPQPGVSPPAAPAAPGPKDGPGETDAFGNSEGKELVASGENKIKQGLLPSLE Predict reactive species\nFull Name: glutaminase\nCalculated Molecular Weight: 669 aa, 73 kDa\nObserved Molecular Weight: 58 kDa, 65 kDa, 83 kDa\nGenBank Accession Number: BC038507\nGene Symbol: GLS\nGene ID (NCBI): 2744\nRRID: AB_2879295\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O94925\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869414019241,"sku":"23549-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-23549-1-ap","provider":"Iright","version":"1.0","type":"link"}