{"product_id":"proteintech-23566-1-ap","title":"Proteintech, 23566-1-AP, VSX1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VSX1 (23566-1-AP) by Proteintech is a Polyclonal antibody targeting VSX1 in WB, IF-P, ELISA applications with reactivity to human,  mouse samples\n23566-1-AP targets VSX1 in WB, IF-P, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse eye tissue, Raji cells\nPositive IF-P detected in: mouse eye tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVSX1(visual system homeobox 1) is a member of the Vsx1 group of vertebrate paired-like homeodomain transcription factors locating to the nucleus. Mutations in the VSX1 gene in keratoconus have been reported in many studies. VSX1 is considered important in ocular development and is particularly involved in the developing cornea (PMID:21139977). And previous studies have identified that Vsx1 participates in regulating retinal progenitor proliferation, differentiation and functional maintenance of bipolar cells (PMID:25150888).It was demonstrated that Vsx1 express in embryonic craniofacial, adult corneal, and adult retinal cDNA libraries.VSX1 mRNA has been found in the outer tier of the inner nuclear layer of the human retina and the cornea (PMID: 21139977).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19222 Product name: Recombinant human VSX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 11-140 aa of BC126228 Sequence: RTSSRALVPGGSPRGSRPRGFAITDLLGLEAELPAPAGPGQGSGCEGPAVAPCPGPGLDGSSLARGALPLGLGLLCGFGTQPPAAARAPCLLLADVPFLPPRGPEPAAPLAPSRPPPALGRQKRSDSVST Predict reactive species\nFull Name: visual system homeobox 1\nCalculated Molecular Weight: 365 aa, 38 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC126228\nGene Symbol: VSX1\nGene ID (NCBI): 30813\nRRID: AB_2879297\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NZR4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887921090729,"sku":"23566-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-23566-1-ap","provider":"Iright","version":"1.0","type":"link"}