{"product_id":"proteintech-23652-1-ap","title":"Proteintech, 23652-1-AP, P15RS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe P15RS (23652-1-AP) by Proteintech is a Polyclonal antibody targeting P15RS in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n23652-1-AP targets P15RS in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, mouse liver tissue,  mouse skeletal muscle tissue,  L02 cells,  Jurkat cells,  HEK-293 cells\nPositive IF\/ICC detected in: HeLa cells, HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRPRD1A is upregulated in cells overexpressing cyclin-dependent kinase inhibitor p15(INK4b) and may have a role in cell cycle regulation. It contains a RAR domain that is involved in regulation of nuclear pre-mRNA, which suggests that P15RS may act as a nuclear regulation protein [PMID:12470661]. It also interacts with phosphorylated C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit POLR2A, and participates in dephosphorylation of the CTD. Besides, RPRD1A regulates cell cycle genes and attenuates WNT signaling [PMID: 20739273], and acts as a negative regulator of cyclin-D1 (CCND1) and cyclin-E (CCNE1) in the cell cycle [PMID: 22231121].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20409 Product name: Recombinant human P15RS protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 82-167 aa of BC010136 Sequence: APVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTLDLV Predict reactive species\nFull Name: regulation of nuclear pre-mRNA domain containing 1A\nCalculated Molecular Weight: 312 aa, 36 kDa\nObserved Molecular Weight: 36 kDa\nGenBank Accession Number: BC010136\nGene Symbol: RPRD1A\nGene ID (NCBI): 55197\nRRID: AB_2879306\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96P16\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869420703913,"sku":"23652-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-23652-1-ap","provider":"Iright","version":"1.0","type":"link"}