{"product_id":"proteintech-23746-1-ap","title":"Proteintech, 23746-1-AP, C20orf112 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C20orf112 (23746-1-AP) by Proteintech is a Polyclonal antibody targeting C20orf112 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n23746-1-AP targets C20orf112 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC20orf112 ,also termed as chromosome 20 open reading frame 112, is a 436 amino acid protein, which consists of a relatively hydrophobic N terminal region and two putative small coiled-coil domains. C20orf112 may likely involve in endocytosis pathway and normal brain development. It  also is required to mediate the cell energy response. The function of C20orf112 is still non-known and mechanism is required to further study.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20690 Product name: Recombinant human C20orf112 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 40-166 aa of BC065370 Sequence: SSESGSGNGSSTLNPSTSSSTQGDPAFPEMNGNGAVAPMDFTTAAEDQPINLCDKLPPATALGTASYPSDGCGADGLRSRVKYGVKTTPESPPYSSGSYDSIKTEVSGCPEDLTVGRAPTADDDDDD Predict reactive species\nFull Name: chromosome 20 open reading frame 112\nCalculated Molecular Weight: 436 aa, 47 kDa\nObserved Molecular Weight: 43 kDa\nGenBank Accession Number: BC065370\nGene Symbol: C20orf112\nGene ID (NCBI): 140688\nRRID: AB_2879315\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q96MY1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885554716841,"sku":"23746-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-23746-1-ap","provider":"Iright","version":"1.0","type":"link"}