{"product_id":"proteintech-23781-1-ap","title":"Proteintech, 23781-1-AP, ADM2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ADM2 (23781-1-AP) by Proteintech is a Polyclonal antibody targeting ADM2 in IHC, ELISA applications with reactivity to human,  mouse samples\n23781-1-AP targets ADM2 in IF, IHC, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human stomach tissue, mouse stomach tissue,  mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nADM2 also named as adrenomedullin 2 or IMDS is a 148 amino-acid secreted protein, which belongs to adrenomedullin family of calcitonin-related peptide hormones and is expressed in the esophagus, stomach, jejunum, ileum, ileocecum, ascending colon, transverse colon, descending colon and rectum. ADM2 activates the cAMP-dependent pathway and may play a role in regulating gastrointestinal and cardiovascular bioactivities. ADM2 play a role in the regulation of peripheral tissues by calcitonin receptor-like receptor.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20548 Product name: Recombinant human ADM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-148 aa of BC012864 Sequence: MARIPTAALGCISLLCLQLPGSLSRSLGGDPRPVKPREPPARSPSSSLQPRHPAPRPVVWKLHRALQAQRGAGLAPVMGQPLRDGGRQHSGPRRHSGPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSYG Predict reactive species\nFull Name: adrenomedullin 2\nCalculated Molecular Weight: 16 kDa\nGenBank Accession Number: BC012864\nGene Symbol: ADM2\nGene ID (NCBI): 79924\nRRID: AB_2879322\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q7Z4H4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869632024745,"sku":"23781-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-23781-1-ap","provider":"Iright","version":"1.0","type":"link"}