{"product_id":"proteintech-23827-1-ap","title":"Proteintech, 23827-1-AP, PRDM10 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PRDM10 (23827-1-AP) by Proteintech is a Polyclonal antibody targeting PRDM10 in WB, IP, ELISA applications with reactivity to human,  mouse samples\n23827-1-AP targets PRDM10 in WB, IP, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\nPositive IP detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPRDM10 is a member of PRDM family, which contains a PR(PRDI-BF1 and RIZ homology) domain, and PRDM is also a subgroup of PR\/SET transcription factor family for its PR domain is similar to  the catalytic motif of the SET domain of histone methyltransferase(HMTase). Thus PRDM is suggested involve in the regulation of genome expression and chromatin remodeling. PRDM10 shares characteristics with the PR\/SET faimly and clusters of zinc fingers DNA binding motifs. It's postualated PRDM10 has an essential role in regulating gene expression and tissue differentiation and a gene repressor. It may play a role in the pathogenesis of gangliosidosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20605 Product name: Recombinant human PRDM10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 806-1156 aa of BC112934 Sequence: AGPGEPDPMLSTHTQLTGTIATPPVCCPHCSKQYSSKTKMVQHIRKKHPEFAQLSNTIHTPLTTAVISATPAVLTTDSATGETVVTTDLLTQAMTELSQTLTTDYRTPQGDYQRIQYIPVSQSASGLQQPQHIQLQVVQVASATSPHQSQQSTVDVGQLHDPQPYPQHAIQVQHIQVSEPTASAPSSAQVSGQPLSPSAQQAQQGLSPSHIQGSSSTQGQALQQQQQQQQNSSVQHTYLPSAWNSFRGYSSEIQMMTLPPGQFVITDSGVATPVTTGQVKAVTSGHYVLSESQSELEEKQTSALSGGVQVEPPAHSDSLDPQTNSQQQTTQYIITTTTNGNGSSEVHITKP Predict reactive species\nFull Name: PR domain containing 10\nCalculated Molecular Weight: 1156 aa, 131 kDa\nObserved Molecular Weight: 120-150 kDa\nGenBank Accession Number: BC112934\nGene Symbol: PRDM10\nGene ID (NCBI): 56980\nRRID: AB_2879330\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NQV6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887772225705,"sku":"23827-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-23827-1-ap","provider":"Iright","version":"1.0","type":"link"}