{"product_id":"proteintech-23940-1-ap","title":"Proteintech, 23940-1-AP, MTTP\/MTP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MTTP\/MTP (23940-1-AP) by Proteintech is a Polyclonal antibody targeting MTTP\/MTP in WB, ELISA applications with reactivity to human, mouse, rat samples\n23940-1-AP targets MTTP\/MTP in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, mouse small intestine tissue,  rat liver tissue,  rat small intestine tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMTTP, also known as MTP, belongs to the lipid transfer protein family and forms a heterodimeric complex with protein disulfide isomerase (PDI) to perform lipid transfer functions. MTTP is isolated as a soluble protein from the lumen of a microsomal fraction of liver and intestine. MTTP assembles triglycerides and apoB in the liver and intestine and subsequently produces apoB-containing lipoproteins. Deficiency in MTTP can cause abetalipoproteinemia, characterized by the absence of apoB-containing lipoproteins from the circulatory system(PMID: 10946006, 23475612).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21045 Product name: Recombinant human MTTP protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-151 aa of BC062696 Sequence: MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGKLQDSVGYRISSNVDVALLWRNPDGDDDQLIQITMKDVNVENVNQQRGEKSIFKGKSPSKIMGKENLEALQRPTLLHLIHGKVKGRLDSTTFSPTSYFSSLQ Predict reactive species\nFull Name: microsomal triglyceride transfer protein\nCalculated Molecular Weight: 151aa,17 kDa; 894aa,99 kDa\nObserved Molecular Weight: 90-100 kDa\nGenBank Accession Number: BC062696\nGene Symbol: MTTP\nGene ID (NCBI): 4547\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: P55157\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887727104169,"sku":"23940-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-23940-1-ap","provider":"Iright","version":"1.0","type":"link"}