{"product_id":"proteintech-23969-1-ap","title":"Proteintech, 23969-1-AP, RCOR2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RCOR2 (23969-1-AP) by Proteintech is a Polyclonal antibody targeting RCOR2 in WB, IHC, ELISA applications with reactivity to human,   mouse samples\n23969-1-AP targets RCOR2 in WB, IHC, CoIP, ELISA applications and shows reactivity with human,   mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells,  HEK-293 cells\nPositive IHC detected in: mouse embryo tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIn mammals, the CoREST (corepressor for element-1-silencing transcription factor) complex is a chromatin-modifying structure that, through interactions with NRSF (neuron restrictive silencer factor), regulates neuronal gene expression and neuronal cell fate. RCOR2 (REST corepressor 2) and RCOR3 (REST corepressor 3) are nuclear proteins that each contain one ELM2 domain and two SANT domains. RCOR2 and RCOR3, both members of the CoREST family, are thought to function as components of the CoREST complex, possibly playing a role in the transcriptional repression of neuronal genes. Additionally, RCOR2 and RCOR3, in conjunction with CoREST, can form immunocomplexes with a variety of histone-modifying genes, including G9a and HDAC1. Via these protein complexes, RCOR2 and RCOR3 can further regulate transcription by controlling the methylation and demethylation of target genes during early development.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21112 Product name: Recombinant human RCOR2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 175-523 aa of BC023587 Sequence: SWKKTRSRTSVMDRQARRLGGRKDKEDSDELEEGRGGVSEGEPDPADPKREPLPSRPLNARPGPGKKEVQVSQYRHHPLRTRRRPPKGMYLSPEGLTAVSGSPDLANLTLRGLDSQLISLKRQVQSMKQTNSSLRQALEGGIDPLRPPEANTKFNSRWTTDEQLLAVQAIRRYGKDFGAIAEVIGNKTLTQVKTFFVSYRRRFNLEEVLQEWEAEQDGAPGAPVPMEEARRGAPLPAPALEEDDEVQITSVSTSVPRSVPPAPPPPPPPTSLSQPPPLLRPPLPTAPTLLRQPPPLQQGRFLQPRLAPNQPPPPLIRPALAAPRHSARPGPQPPPTLIGAPLEPPAPSL Predict reactive species\nFull Name: REST corepressor 2\nCalculated Molecular Weight: 523 aa, 58 kDa\nObserved Molecular Weight: 58 kDa\nGenBank Accession Number: BC023587\nGene Symbol: RCOR2\nGene ID (NCBI): 283248\nRRID: AB_2879382\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q8IZ40\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869008646313,"sku":"23969-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-23969-1-ap","provider":"Iright","version":"1.0","type":"link"}