{"product_id":"proteintech-23997-1-ap","title":"Proteintech, 23997-1-AP, AMPD3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AMPD3 (23997-1-AP) by Proteintech is a Polyclonal antibody targeting AMPD3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n23997-1-AP targets AMPD3 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: RAW 264.7 cells, rat kidney tissue,  HEK-293 cells,  mouse kidney tissue,  mouse lung tissue\nPositive IP detected in: mouse kidney tissue\nPositive IHC detected in: human colon tissue, mouse placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21199 Product name: Recombinant human AMPD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-138 aa of BC126118 Sequence: MALSSEPAEMPRQFPKLNISEVDEQVRLLAEKVFAKVLREEDSKDALSLFTVPEDCPIGQKEAKERELQKELAEQKSVETAKRKKSFKMIRSQSLSLQMPPQQDWKGPPAASPAMSPTTPVVTGATSLPTPAPYAMPE Predict reactive species\nFull Name: adenosine monophosphate deaminase (isoform E)\nCalculated Molecular Weight: 776 aa, 90 kDa\nObserved Molecular Weight: 70 kDa, 90 kDa\nGenBank Accession Number: BC126118\nGene Symbol: AMPD3\nGene ID (NCBI): 272\nRRID: AB_2879396\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q01432\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868962672809,"sku":"23997-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-23997-1-ap","provider":"Iright","version":"1.0","type":"link"}